PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010528106.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family S1Fa-like
Protein Properties Length: 75aa    MW: 8165.76 Da    PI: 10.3816
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010528106.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA1291.4e-40975370
            S1FA  3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                    ++++eakGlnPGlivllvvg+ll vflv+ny+ly+yaqknlPP+ kkPvskkklkreklkqGv+vPGe
  XP_010528106.1  9 EVNAEAKGLNPGLIVLLVVGTLLSVFLVANYVLYMYAQKNLPPK-KKPVSKKKLKREKLKQGVPVPGE 75
                    6789***************************************6.68********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046893.1E-361275IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
MDGDNFAGEV NAEAKGLNPG LIVLLVVGTL LSVFLVANYV LYMYAQKNLP PKKKPVSKKK  60
LKREKLKQGV PVPGE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010528106.13e-46PREDICTED: DNA-binding protein S1FA1-like
SwissprotQ423371e-20S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBLW9SCA31e-21W9SCA3_9R
STRINGAT2G37120.13e-18(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37120.12e-08S1FA-like DNA-binding protein